) MS-275 manufacturer R.Br latex. The isolation procedure required two cation exchange chromatography steps on 50 mM Na-acetate buffer (pH 5.0) CM-Sepharose

Fast Flow and 25 mM Na-phosphate buffer (pH 6.0) Resource-S, respectively. The protein purity was confirmed by an unique N-terminal sequence [ATFTIRNNCPYTI-WAAAVPGGGRRLNSGGTWTINVAPGTA]. The osmotin (CpOsm) appeared as a single band (20,100 Da) in sodium dodecyl sulfate-polyacrylamide gel electrophoresis and as two spots in two-dimensional electrophoresis (pI 8.9 and 9.1). Both polypeptides were further identified by mass spectrometry as two osmotin isoforms with molecular masses of 22,340 and 22,536 Da. The CpOsm exerted antifungal activity against Fusarium solani (IC(50) = 67.0 mu g mL(-1)), Neurospora sp.

(IC(50) = 57.5 mu g mL(-1)) and Colletotrichum gloeosporioides (IC(50)= 32.1 mu g mL(-1)). However, this activity was lost when the protein was previously treated with a reducing agent (DTT, Dithiothreitol) suggesting the presence of disulfide bounds stabilizing the protein. The occurrence of osmotin in latex substantiates the defensive role of these fluids. (C) 2011 Elsevier Masson SAS. All rights reserved.”
“Gas hold-up (epsilon(g)), sauter SB203580 chemical structure mean bubble diameter (d(32)) and oxygen transfer coefficient (k(L)a) were evaluated at four different alkane concentrations PU-H71 (0.05, 0.1, 0.3 and 0.5 vol.%) in water over the range of superficial gas velocity (u(g)) of (1.18-23.52) x 10(-3) m/s at 25 degrees C in a laboratory-scale bubble column bioreactor. Immiscible hydrocarbons (n-decane, n-tridecane and n-hexadecane) were utilized in the experiments as impurity. A type of anionic surfactant was also employed in order to investigate the effect of addition of surfactant to organic-aqueous systems on sauter mean bubble diameter, gas hold-up and oxygen transfer coefficient. Influence of addition of alkanes on oxygen transfer coefficient

and gas hold-up, was shown to be dependent on the superficial gas velocity. At superficial gas velocity below 0.5 x 10(-3) m/s, addition of alkane in air-water medium has low influence on oxygen transfer coefficient and also gas hold-up, whereas; at higher gas velocities slight addition of alkane increases oxygen transfer coefficient and also gas hold-up. Increase in concentration of alkane resulted in increase in oxygen transfer coefficient and gas hold-up and roughly decrease in sauter mean bubble diameter, which was attributed to an increase in the coalescence-inhibiting tendency in the presence of surface contaminant molecules. Bubbles tend to become smaller with decreasing surface tension of hydrocarbon, thus, oxygen transfer coefficient increases due to increasing of specific gas-liquid interfacial area (a).

Studies indicated that the piroxicam ceramic nanoparticle formulations elicited release of piroxicam in 1 h 15 min. This result also indicated specific interaction Hippo pathway inhibitor of piroxicam and trehalose. In the absence of sugar adsorption, the piroxicam release was to the tune of 90% in 60 min., which can be usefully exploited for the immediate action.”
“Osteoporosis

is an escalating global problem. Hip fractures, the most catastrophic complication of osteoporosis, continue to cause significant mortality and morbidity despite increasing availability of effective preventative agents. Among these agents, oral bisphosphonates have been the first choice for the treatment and prevention of osteoporotic fractures. However, the use of oral bisphosphonates, especially in the older population, has been limited by their AZD6244 in vivo side effects and method of administration thus compromising their persistent use. The resultant low adherence by patients has undermined their full potential and has been associated with an increase in the incidence of fragility fractures. Recently, annual intravenous zoledronic acid (ZOL) has been approved for osteoporosis.

Randomized controlled trials have demonstrated ZOL to be safe, have good tolerability and produce significant effect on bone mass and micro-architecture. Adherence has also been shown to be better with ZOL. Furthermore two large trials firmly demonstrated significant anti-osteoporotic effect (similar to 59% relative risk reduction of hip fractures) and mortality benefit (28% reduction in mortality)

of ZOL in older persons with recent hip fractures. In click here this review, we report the current evidence on the use of ZOL for the prevention of hip fractures in the elderly. We also report the pharmacological characteristics and the advantages and disadvantages of ZOL in this particular group.”
“Objective To determine clinical signs and outcomes of methylphenidate hydrochloride (MPH) toxicosis in dogs; to assess effects of amount lie, dose) and formulation (immediate or extended release) of ingested MPH on onset, duration, and severity of clinical signs; and to describe management of MPH intoxication.

Design Retrospective case series.

Animals-128 dogs with MPH toxicosis or exposure.

Procedures Data from an Animal Poison Control Center (APCC) database from November 1, 2001, to November 30, 2008, were reviewed. Records of dogs were searched for APCC classifications of confirmed (n = 71) or suspected (39) MPH toxicosis; dogs (18) that ingested MPH but did not develop clinical signs of toxicosis were also included. Signalment, dose, clinical signs, treatment, and outcome were evaluated.

Results Clinical signs of toxicosis were reported in 107 of 128 (84%) dogs that ingested MPH; these included hyperactivity in 42 (33%), tachycardia in 27 (21%), vomiting in 19 (15%), agitation in 16 (13%), and hyperthermia in 13 (10%). Doses ranged from 0.36 mg/kg (0.164 mg/lb) to 1170 mg/kg (53.18 mg/lb).

Drug adherence was measured using the medication possession ratio. Multivariate analyses, including logit and multinomial logit were used. Of the 170,381 diabetics (mean age: 62 +/- 14 years), 18% and 32%

were find more regular users of ASA and ACEIs/ARBs, respectively. Regular use increased with age (p < 0.0001) and comorbidities (p < 0.0001). Rural inhabitants were more likely to use ACEIs/ARBs (OR: 1.29; 95% CI: 1.26-1.32) and to be regular users (OR: 1.36; 95% CI: 1.32-1.39). Similar results were found for ASA. In conclusion, despite the high cardiovascular risks associated with diabetes, less than one-third of diabetic adults took vascular-protection drugs regularly. This important issue needs proper attention.”
“Automated

monitoring of circadian rhythms is an efficient way of gaining insight into oscillation parameters like period and phase for the underlying pacemaker of the circadian clock. Measurement of the circadian rhythm of phototaxis (swimming towards light) exhibited by the green alga Chlamydomonas reinhardtii has been automated by directing a narrow and dim light beam through a culture at regular intervals and determining the decrease in light transmittance due to the accumulation of cells in the beam. In this study, the monitoring process was optimized by constructing a new computer-controlled measuring machine that limits the test beam to wavelengths reported to be specific for phototaxis and by choosing an algal strain, which does not need background illumination between test light cycles for proper expression of the rhythm. As a result, HM781-36B period and phase of the rhythm are now unaffected by the time a culture is placed into the machine. Analysis of the rhythm data was also optimized through a new algorithm, whose robustness was demonstrated using virtual rhythms with various noises. The algorithm differs in particular from other reported algorithms by maximizing the fit of the data to a sinusoidal curve that dampens exponentially. The algorithm was also used to confirm the reproducibility of rhythm monitoring by the machine. Machine and algorithm

can now be used for a multitude of circadian clock studies that require unambiguous period and phase determinations such as Selleck BV-6 light pulse experiments to identify the photoreceptor(s) that reset the circadian clock in C. reinhardtii. (c) 2010 Elsevier Masson SAS. All rights reserved.”
“Fifty-five bacteria with gelatinolytic activity were screened from over 500 isolates obtained from fishing docks in Songkhla, Thailand. Based on 16S rRNA gene sequence analysis, 3 selected strains (K12, O02, and S13) were identified as Bacillus cereus with 99.8% similarity. Three other stains (D10, G02, and H11) were identified as Bacillus amyloliquefaciens with 99.7% similarity. Gelatinolytic enzymes of the D10, G02, and H11 strains were precipitated using ammonium sulfate precipitation, followed by dialysis with an increase in purity between 19-34-fold.

Only a few studies, however, have examined relationship between fatigue and work-related outcomes. The aim of this study was to investigate which disease-related factors (treatment, diagnosis, cognitive dysfunction, depression, pain, and sleep disturbance) and work-related factors (work-load, work pressure, relationship to supervisor and colleagues, size

of the company, and workplace accommodations) were related to fatigue in employed cancer survivors.

Methods: Data was collected by questionnaire at 6 months (baseline) and 18 months (end of the follow-up) after cancer diagnosis from 135 people with different types of cancer who had returned to work at follow-up. Fatigue was measured with a four-item sub-scale of MFI. Scores ranged dbcAMP from 4 to 20, with higher scores indicating more fatigue.

Results: The mean rate of general fatigue was 11.9 at baseline decreasing to 10.4 at the end of the follow-up (p<0.0001). At 6 months, higher work pressure (p = 0.02), physical workload (p<0.05) and less workplace accommodations (p = 0.03) were related to higher levels of fatigue. From disease-related factors, depression was associated with fatigue (p<0.0001) at baseline. Lack of workplace accommodations

was the only factor affecting higher levels of fatigue at 18 months (p<0.001) and was also related to higher levels of depression at 6 months (p https://www.selleckchem.com/products/pifithrin-alpha.html = 0.02) and at 18 months (p<0.001).

Conclusions: Lack of workplace accommodations was significantly related to fatigue at the end of the follow-up, which suggests that accommodations for illness can help to reduce fatigue and depression. Copyright (C) 2010 John Wiley & Sons, Ltd.”
“Purpose: The metabolism of cancerous cells is in many ways different than in healthy cells. In ovarian cancer, cells exhibit activity of alcohol dehydrogenase (ADH) and aldehyde dehydrogenase (ALDH), which

participate in metabolism of many biological substances. The aim of this study was to compare the metabolism of ovarian cancer cells, ovarian cysts and normal ovarian cells by measurement of ADH isoenzymes and ALDH activities.

Material and Methods: The study material consisted of 36 cancerous ovarian tissues. Class III, IV of ADH and total ADH activity Cytoskeletal Signaling inhibitor was measured by the photometric method and class I, II ADH and ALDH activity by the fluorometric method with class-specific fluorogenic substrates.

Results: The activity of the class I ADH isoenzyme and the total ADH was significantly higher in ovarian cancer as compared to ovarian cysts and healthy tissues but there are no significant differences between ovarian cysts and healthy cells. The other classes of ADH tested, did not show significant differences between activity of cancerous cells and healthy ovary.

Study design: We used 32 single-rooted teeth that underwent a root canal and apical resection. Afterwards, the teeth were divided into 4 groups of 8 teeth each, with preparations of the apical cavities in the following manner: Group 1: stainless steel ultrasonic tip at 33KHz. Group 2: stainless steel ultrasonic tip at 30KHz. Group 3: diamond ultrasonic tip at 30KHz. Group 4: diamond ultrasonic tip at 33 KHz. The quality of the root surface and the presence of cracks were evaluated by one single observer using a scanning electron microscope.

Results: selleck All of the teeth in our study had cracks after the apical preparations. The mean number of cracks per tooth ranged

between 6.1 +/- 1.9 (group 1) and 3.5 +/- 2.4 (group 4), with a significantly higher number found in the groups that used stainless steel tips (P=.03). The types of cracks

produced involved: 8 complete cracks (4.5%), 167 incomplete cracks (94.4%), and 2 intradentinal cracks (1.1%), with no significant differences observed between the different frequencies used for each group.

Conclusions: Stainless steel ultrasonic tips provoked a larger number of cracks than diamond tips. The frequency of vibration used did not have any effect on the number of cracks found.”
“Purpose of review

Disease states characterized by abnormal cellular function or proliferation frequently reflect aberrant genetic information. By revealing disease-specific DNA mutations, we gain insight into normal physiology, Givinostat order pathophysiology, potential

therapeutic targets and are better equipped to evaluate an individual’s disease risks. This review examines recent advances in our understanding of the genetic basis of adrenal LY2157299 mw cortical disease.

Recent findings

Important advances made in the past year have included identification of KCNJ5 potassium channel mutations in the pathogenesis of both aldosterone-producing adenomas and familial hyperaldosteronism type III; characterization of phosphodiesterase 11A as a modifier of phenotype in Carney complex caused by protein kinase, cAMP-dependent, regulatory subunit, type-I mutations; the finding of 11 beta-hydroxysteroid dehydrogenase type I mutations as a novel mechanism for cortisone reductase deficiency; and demonstration of potential mortality benefit in pursuing comprehensive presymptomatic screening for patients with Li-Fraumeni syndrome, including possible reduction in risks associated with adrenocortical carcinoma.

Summary

This research review provides a framework for the endocrinologist to maintain an up-to-date understanding of adrenal cortical disease genetics.”
“Human follicular fluid constitutes the microenvironment of follicles and includes various biological active proteins that can affect follicle growth and oocyte fertilization.

g. during a clinical trial, against which changes in the behaviour of the immune system can be detected more accurately in future.”
“Background: Suicide is a major problem in schizophrenia, estimated to affect 9%-13% of patients. About 25% of schizophrenic patients make at least one suicide attempt in their lifetime. Current outcome measures do not address this problem, even

though it affects quality of life and patient safety. The aim of this study was to assess suicidality in long-term clinically improved schizophrenia patients who were treated in a nongovernmental psychiatric treatment centre in Mumbai, India.

Method: Participants were 61 patients out of 200 consecutive hospitalized first-episode patients with schizophrenia buy JNJ-26481585 diagnosed according to the Diagnostic and Statistical Manual of Mental Disorders who were much improved on the Clinical Global Impression Scale-Improvement (CGI-I) Elacridar scale at the endpoint of a 10-year follow-up. Clinical assessment tools included the Positive and Negative Syndrome Scale for Schizophrenia, CGI-I, Global Assessment of Functioning, and suicidality.

Results: Many of the patients, although clinically improved, experienced emerging suicidality during the 10-year follow-up period. All of the patients

reported significant suicidality (ie, suicide attempts, suicidal crises, or suicidal ideation) at the end of the study, whereas only 83% had reported previous significant suicidality at baseline. No sociodemographic and clinical variables at baseline were predictive of suicidal status at the end of the 10-year follow-up.

Conclusion: Schizophrenia is a complex neurobehavioral JQ1 purchase disorder that appears to be closely associated with suicidal behavior. Adequate assessment and management of suicidality needs to be a continual process, even in patients who respond well to treatment.”
“Objective

Stapediovestibular luxations are rare lesions that are most commonly caused by direct, penetrating trauma to the external ear canal. In this type of ossicular dislocation, disruption

of the annular ligament or footplate fracture may lead to a perilymphatic fistula (PLF) presenting with cochleovestibular symptoms including (progressive) sensorineural hearing loss, tinnitus, and vestibular symptoms. The objective of this article is to define the optimal treatment of stapediovestibular luxations and review the literature on this topic.

Patient

We present a case of internal stapediovestibular dislocation and pneumolabyrinth after penetrating trauma with predominantly conductive hearing loss and incapacitating vertigo.

Intervention

Middle ear inspection with removal of the luxated incus, repositioning of the stapes with a “”stapedial strut”" and closure of the tympanic membrane.

The OR for CAD for the last quintile of the accumulated number of risk alleles relative to the first was 2.21 (95% Cl,

1.87-2.61; P=5 x 10(-21)).

Conclusions. A genetic risk score based on nine genetic variants independently associated with CAD irrespective of other cardiovascular risk factors was associated with the presence of the disease. Cohort studies are needed to determine whether this genetic risk score can improve the predictive capacity or the risk classification of classical risk functions.”
“To evaluate the beneficial Ricolinostat effects of Implanon on pelvic pain in women with pelvic congestion syndrome (PCS). The efficacy of pain control, amount and frequency of menstrual loss, degree of patient’s satisfaction and objective pelvic venography scores were investigated.

In a prospective open-labelled study, 25 consecutive women complaining of chronic pelvic pain were recruited. Pretreatment objective peruterine venography and diagnostic laparoscopy of pure PCS together with subjective pelvic pain scores, prefilled questionnaire of Hospital Anxiety and Depression Scale (HADS), selleck inhibitor visual analogue scale (VAS), verbal rating scale (VRS) and quantified menstrual loss using the pictorial blood loss chart were documented in all cases. After identification, 23 subjects

with pure PCS were randomly assigned to have either Implanon inserted subcutaneously (12 cases) or no treatment (11 cases). Patients were followed up at 1, 3, 6, 9 and 12 months. A symptom diary for side effects, VAS, VRS and menstrual scores were used to assess the subjective response to treatment. At the end of the study, all patients underwent repeat venography to assess buy Geneticin the long-term objective response. After 12 months, subjects having Implanon inserted were requested to rate their overall degree of satisfaction with therapy.

All 25 women recruited in the study completed follow-up. Two cases were excluded from the study and referred to the psychiatry department after a negative evaluation for disease and HADS scores relevant for depression. An improvement in symptoms was observed throughout the 12 months amongst the Implanon group versus no treatment. The

greatest changes in pain assessed using either the VAS or VRS were between the pretreatment scores and those after 6 months (7.7 +/- A 1.3 vs. 4.6 +/- A 3.0 for VAS, P < 0.001; and 25 +/- A 13.8 vs. 19 +/- A 18.9 for VRS, P < 0.002). The monthly quantified blood loss fell from 204 (196) pretreatment to 90 (157) at 6 months (P < 0.001) and then to 64 (32) at 9 months (P < 0.002). Objective repeat venography score was reduced significantly at 1 year after treatment compared with the baseline evaluation as well as with the control group (4.5 +/- A 1.2 vs. 8.6 +/- A 0.5; P = 0.001 and 4.2 +/- A 0.9 vs. 8.5 +/- A 0.6; P = 0.0002, respectively). At final satisfaction assessment, 2 (17%) women were very satisfied 8 (66%) were satisfied, and 2 (17%) were uncertain.

Materials and Methods: A 6-month prospective clinical trial was conducted at the Department of Obstetrics and Gynecology, Dr Lutfi Kirdar Kartal Education and Research Hospital, Istanbul, Turkey. Ninety postmenopausal women were accepted to be part of the study. The Euro Quality

of Life-5 Dimensions Go 6983 inhibitor (EQ-5D) and Euro Quality of Life Visual Analogue Scale (EQ VAS) indexes for HRQoL and Kupperman indexes were compared between two groups of patients.

Results: Kupperman indexes of both treatment groups decreased gradually over 6 months, but indexes decreased significantly more in the group with intrauterine-system-releasing 20 mg daily of levonorgestrel. Elevations were observed in EQ-5D indexes and VAS values of both groups.

EQ VAS values significantly increased in the group on intrauterine progestogen system. Similar changes were observed in the EQ-5D indexes of both groups.

Conclusion: A hormone replacement therapy regimen that includes an intrauterine progestin system decreased climacteric symptoms and increased HRQoL in postmenopausal women during a follow-up period of 6 months. https://www.selleckchem.com/products/kpt-8602.html The extent of the relief of symptoms was greater in this group than in women receiving oral combined hormone replacement therapy. It seems therefore that the intrauterine progestin system could represent a method of choice for endometrial suppression in women using estrogen replacement therapy with distinct advantages over systemically administered progestogens, which have been the subject of considerable debate as reported in the recent literature.”
“Coconut water is becoming an increasingly popular beverage and sports drink in tropical countries due

to its high mineral content. Probiotic fermentation of coconut water would provide consumers with a novel probiotic beverage which can provide both hydration and probiotic benefits. The aim of this study was to assess the growth, survival and fermentation performance of two probiotic bacteria in coconut water. Lactobacillus acidophilus L10 and L. casei L26 grew well in coconut water and showed similar growth patterns. The viable cell count of the two probiotic cultures reached approximately 10(8) CFU/ml after 2 days fermentation at 37 A degrees C and 20s Proteasome activity maintained approximately10(7)-10(8) CFU/ml after 26 days at 4 A degrees C. Changes in total soluble solids ((o)Brix), pH, sugars, organic acids and minerals were similar between the two probiotic cultures, except for fructose, glucose, copper, phosphorus and lactic, acetic and malic acids. There were significant variations between the two cultures in their ability to produce and consume these compounds. L. acidophilus produced higher amounts of 2-heptanone, 2-nonanone, benzaldehyde, 2-heptanol, 2-nonanol, delta-octalactone and delta-dodecalactone, whereas L.

“
“In order to perform material interaction studies with intense extreme ultraviolet (EUV) radiation, a Schwarzschild mirror objective coated with Mo/Si multilayers was adapted to a compact laser-driven EUV plasma source utilizing a solid Au target.

By 10X demagnified imaging of the plasma a maximum pulse energy density of similar to 0.73 J/cm(2) at a wavelength of 13.5 nm can be achieved in the image plane of the objective at a pulse duration of 8.8 ns. In this paper we present EUV photoetching rates measured for polymethyl methacrylate, polycarbonate, and polytetrafluoroethylene at various fluence levels. A linear dependence between etch depth and applied EUV pulse number could be observed without the necessity for any incubation pulses. By evaluating the slope of these data, etch C59 inhibitor rates were determined, revealing also a linear behavior for low fluences. A threshold energy density could not be observed. The slope of the linear etch regime as well as deviations from the linear trend at higher energy densities are discussed and compared to

data known from deep UV laser ablation. Furthermore, the surface roughness of the structured polymers was measured by atomic force microscopy and compared to the nonirradiated polymer surface, indicating a rather smooth etch process (roughness increase of 20%-30%). The different shapes of the etch craters observed for the three polymers at high energy densities can be explained by the measured fluence dependence of the etch rates, having consequences for the proper use of polymer ablation for beam profiling of focused EUV radiation. (C) 2009 American FK506 concentration Institute of Physics. [DOI: 10.1063/1.3054565]“
“Background: Migraine without aura (MoA)

is a painful syndrome, particularly in childhood; it is often accompanied by severe impairments, including emotional dysfunction, absenteeism from school, learn more and poor academic performance, as well as issues relating to poor cognitive function, sleep habits, and motor coordination.

Materials and methods: The study population consisted of 71 patients affected by MoA (32 females, 39 males) (mean age: 9.13 +/- 1.94 years); the control group consisted of 93 normally developing children (44 females, 49 males) (mean age: 8.97 +/- 2.03 years) recruited in the Campania school region. The entire population underwent a clinical evaluation to assess total intelligence quotient level, visual-motor integration (VMI) skills, and motor coordination performance, the later using the Movement Assessment Battery for Children (M-ABC). Children underwent training using the Wii-balance board and Nintendo Wii Fit Plus (TM) software (Nintendo Co, Ltd, Kyoto, Japan); training lasted for 12 weeks and consisted of three 30-minute sessions per week at their home.

Results: The two starting populations (MoA and controls) were not significantly different for age (P=0.899) and sex (P=0.611).

The meta-analyses identified 8 novel loci for BP phenotypes, which physically mapped in or near PRMT6 (P=7.29×10(-9)), CDCA7 (P=3.57×10(-8)), PIBF1 (P=1.78×10(-9)), ARL4C (P=1.86×10(-8)), IRAK1BP1 (P=1.44×10(-10)), SALL1 (P=7.01×10(-13)), TRPM8 (P=2.68×10(-8)), and FBXL13 (P=3.74×10(-9)). There was a strong dose-response relationship between the number of risk alleles of these independent single-nucleotide polymorphisms and

the risk of developing hypertension during the 7.5-year follow-up in the study participants. Compared with those in the lowest quartile of risk alleles, odds ratios (95% confidence intervals) for those in the second, third, and fourth Anlotinib nmr quartiles were 1.39 (0.97, 1.99), 1.72 (1.19, 2.47), and 1.84 (1.29, 2.62), respectively (P=0.0003 for trend).

Conclusions Our study identified 8 novel loci for BP responses to dietary sodium and potassium intervention and cold pressor test. The effect size of these novel loci on BP phenotypes is much larger than those reported Entrectinib by the previously published studies. Furthermore, these variants predict the risk of developing hypertension among individuals with normal BP at baseline.”
“We prepared multiferroic Y-type hexaferrite Ba0.5Sr1.5Zn2Fe12O22 ceramics and compared their magnetic and dielectric properties

with single crystal. Magnetic susceptibility and microwave resonance measurement revealed magnetic phase transition at T-C = 312 K, similar as in single crystal. Ferroelectric (FE) phase can be induced by external magnetic field in all investigated samples and the phase diagram in ceramics qualitatively resembles that of the single crystal. The range of magnetic fields, where the FE phase is induced, broadens after annealing of single crystal. Pictilisib mw Ceramics quenched after sintering exhibit several orders of magnitude lower conductivity than the single crystal.

Heavily damped magnetic resonance was discovered in terahertz spectra at 10 K and its frequency softens below 5 GHz near T-C. Number and symmetry of observed infrared (IR) and Raman active phonons correspond to paraelectric phase with D-3d(5) hexagonal structure. No evidence for a structural phase transition was found in the IR and Raman spectra on cooling (in zero magnetic field) or in the room-temperature IR spectra with external static magnetic field up to 0.3 T. (C) 2010 American Institute of Physics. [doi: 10.1063/1.3402379]“
“Background Blood pressure (BP) tends to increase across childhood and adolescence, but the genetic influences on rates of BP change are not known. Potentially important genetic influences could include genetic variants identified in genome-wide association studies of adults as being associated with BP, height, and body mass index. Understanding the contribution of these genetic variants to changes in BP across childhood and adolescence could yield understanding into the life course development of cardiovascular risk.